Teriparatide is a 34-amino acid polypeptide, chemically the N-terminal fragment 1-34 of human parathyroid hormone. In scientific research, it is studied as a model compound for the activation of class B receptors and as a reference standard in analytical and biophysical work. This compound is offered as a freeze-dried powder of 10 mg per sealed vial, exclusively for laboratory and research purposes.<\/p>\n
Teriparatide, also designated as PTH(1-34) or hPTH 1-34, comprises the first 34 amino acids of the 84-amino acid parent hormone, with the sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe. Functionally, the fragment divides into two parts: the outermost N-terminal segment determines activation, while the C-terminal part primarily determines affinity. In solution, under suitable conditions, the peptide forms two short amphipathic helices with a flexible hinge region between them, a structure that can be easily monitored using circular dichroism and NMR. The two methionine residues at positions 8 and 18 are susceptible to oxidation, making the fragment a useful model for research into peptide degradation.<\/p>\n
In research models, Teriparatide binds to the PTH1 receptor, a G-protein-coupled class B receptor with a large extracellular domain. According to the standard two-domain model, the C-terminal part of the peptide first binds to that extracellular domain, after which the N-terminal part slides into the transmembrane cavity and brings the receptor into an active conformation. In cell models, this leads to activation of both the Gs-cAMP pathway and the Gq-phospholipase-C pathway; the ratio between the two is a widely used starting point for research into signal selectivity. Consequently, Teriparatide is used as a model compound and reference substance within scientific research.<\/p>\n
In a laboratory context, Teriparatide occurs in the following research areas, among others:<\/p>\n
Cada uma destas aplica\u00e7\u00f5es envolve investiga\u00e7\u00e3o controlada em laborat\u00f3rio ou em modelos pr\u00e9-cl\u00ednicos.<\/p>\n
Teriparatide falls under the category of freeze-dried peptides in sealed vials within our product range. While Teriparatide targets a class B receptor with a large extracellular domain, other components within the same product line focus on shorter chains or enzymatic targets. They share the freeze-dried form and associated storage requirements, but differ fundamentally in chain length and investigated mechanism.<\/p>\n
| Especifica\u00e7\u00e3o<\/th>\n | Valor<\/th>\n<\/tr>\n<\/thead>\n | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amostra<\/td>\n | Teriparatide<\/td>\n<\/tr>\n | ||||||||||||
| Sin\u00f4nimos<\/td>\n | PTH(1-34); hPTH 1-34; parathyroid hormone fragment 1-34<\/td>\n<\/tr>\n | ||||||||||||
| N\u00famero CAS<\/td>\n | 52232-67-4<\/td>\n<\/tr>\n | ||||||||||||
| F\u00f3rmula molecular \/ peso<\/td>\n | C181<\/sub>H291<\/sub>N55<\/sub>O51<\/sub>S2<\/sub> \/ 4118 Da<\/td>\n<\/tr>\n| PubChem CID<\/td>\n | 16133850<\/td>\n<\/tr>\n | Sequ\u00eancia<\/td>\n | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (34 amino acids)<\/td>\n<\/tr>\n | Aula<\/td>\n | Polypeptide, hormone fragment; ligand of the PTH1 receptor<\/td>\n<\/tr>\n | Forma<\/td>\n | Freeze-dried powder (lyophilisate)<\/td>\n<\/tr>\n | Quantidade por frasco<\/td>\n | 10 mg<\/td>\n<\/tr>\n | Armazenar<\/td>\n | Freeze-dried, store in a cool, dark place; in solution, refrigerated and protected from light.<\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n | Formato, manuseamento e armazenamento<\/h2>\nTeriparatide is supplied as a freeze-dried powder in a sealed vial containing 10 mg per unit. The lyophilisate is a solid, powdery to slightly spongy mass that is only brought into solution in the laboratory setup, according to the laboratory's own procedure. Peptides of this chain length are significantly more stable in solid form than in solution.<\/p>\n Store the unopened vial in a cool, dry, and dark place in the original packaging; avoid exposure to room temperature, moisture, and direct light. Handle the material with standard laboratory precautions: work in a clean environment, use appropriate personal protective equipment, and prevent cross-contamination with other research materials. Keep the packaging out of reach of unauthorized persons.<\/p>\n Composi\u00e7\u00e3o e resultados laboratoriais<\/h2>\nThe material in the vial consists of the freeze-dried peptide fragment with a controlled purity of \u2265 99% (HPLC). In the case of a lyophilized product, the quality is expressed as a purity percentage, whereby chromatographic separation also reveals related chains and oxidation products.<\/p>\n |